(data stored in ACNUC7421 zone)

EMBL: BA000007.YDCC

BA000007.YDCC        Location/Qualifiers
FT   CDS             272653..273789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcC"
FT                   /locus_tag="ECs_0241"
FT                   /product="H repeat-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33664"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33664"
FT                   /db_xref="GOA:Q8X4R7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X4R7"
FT                   /protein_id="BAB33664.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDFGETHLDFLRQYGDFENAIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKD
FT                   VIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAPPELLNILD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAISEKSHGREEIRLHIVCEVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPKMTV
FT                   RYYISSADLTAGKFATAIRNHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVLAGSGLS"
     MELKKLMEHI SIIPDYRQAW KVEHKLSDIL LLTICAVISG AEGWEDIEDF GETHLDFLRQ        60
     YGDFENAIPV HDTIARVVSC ISPAKFHECF INWMRDCHSS DDKDVIAIDG KTLRHSYDKS       120
     RRRGAIHVIS AFSTMHSLVI GQIKTDEKSN EITAPPELLN ILDIKGKIIT TDAMGCQKDI       180
     AEKIQKQGGD YLFAVKGNQG RLNKAFEEKF PLKELNNPEH DSYAISEKSH GREEIRLHIV       240
     CEVPDELIDF TFEWKGLKKL CVAVSFRSII AEQKKEPKMT VRYYISSADL TAGKFATAIR       300
     NHWHVENKLH WRLDVVMNED DCKIRRGNAA ELFSGIRHIA INILTNDKVF KAGLRRKMRK       360
     AAMDRNYLAS VLAGSGLS                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page