(data stored in ACNUC7421 zone)

EMBL: BA000007.YFDK

BA000007.YFDK        Location/Qualifiers
FT   CDS             complement(305988..306431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdK"
FT                   /locus_tag="ECs_0282"
FT                   /product="phage tail fiber assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33705"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33705"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFK4"
FT                   /protein_id="BAB33705.1"
FT                   /translation="MDEYVYSARHNAFFPVDMIDKYKSEGWDLSDAKEVNQNIISEFMA
FT                   EPPQGKIRIAGDDGLPAWADIPPPTHEELIEITESERQLLINQANEYMNSKQWPGKAAI
FT                   GRLKGDELTQYNLWLDYLDALELVDTSGAPDIEWPTPPAVQAR"
     MDEYVYSARH NAFFPVDMID KYKSEGWDLS DAKEVNQNII SEFMAEPPQG KIRIAGDDGL        60
     PAWADIPPPT HEELIEITES ERQLLINQAN EYMNSKQWPG KAAIGRLKGD ELTQYNLWLD       120
     YLDALELVDT SGAPDIEWPT PPAVQAR                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page