(data stored in ACNUC7421 zone)

EMBL: BA000007.YFDL

BA000007.YFDL        Location/Qualifiers
FT   CDS             complement(306452..306862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdL"
FT                   /locus_tag="ECs_0283"
FT                   /product="phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33706"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC56"
FT                   /protein_id="BAB33706.1"
FT                   /translation="MPFARYFCIFINVGLGEAAKRDVGTGENQIPDMASFASGNGWMKL
FT                   PNGKILQYGRGAVTPTLSTQTMRITFSIPFPKKADCAMLTHSGDGGAPLGAGRGFVMTA
FT                   EGPTLTGFNSAYRTSSTSDTVSMNYSWWAVGE"
     MPFARYFCIF INVGLGEAAK RDVGTGENQI PDMASFASGN GWMKLPNGKI LQYGRGAVTP        60
     TLSTQTMRIT FSIPFPKKAD CAMLTHSGDG GAPLGAGRGF VMTAEGPTLT GFNSAYRTSS       120
     TSDTVSMNYS WWAVGE                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page