(data stored in ACNUC7421 zone)

EMBL: BA000007.YIBG

BA000007.YIBG        Location/Qualifiers
FT   CDS             271362..271907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yibG"
FT                   /locus_tag="ECs_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33661"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33661"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7S7"
FT                   /protein_id="BAB33661.2"
FT                   /translation="MDNSKHSDEAEKLLAELSARKGEGEGEGEGEGEGEGEGEPKSTVS
FT                   VFYLQPEEVNTLSHQAKRGDGEAGFRLFLYYKLSNYDEEKSSQWLKIAANNGHATAQYR
FT                   LYVELQEQGETKEANEWLQKIKLAASNNDSSAIWFLVNCYKNQGNKKEALQWAYKLKAS
FT                   KQPLDADRLIEELTKEQK"
     MDNSKHSDEA EKLLAELSAR KGEGEGEGEG EGEGEGEGEP KSTVSVFYLQ PEEVNTLSHQ        60
     AKRGDGEAGF RLFLYYKLSN YDEEKSSQWL KIAANNGHAT AQYRLYVELQ EQGETKEANE       120
     WLQKIKLAAS NNDSSAIWFL VNCYKNQGNK KEALQWAYKL KASKQPLDAD RLIEELTKEQ       180
     K                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page