(data stored in ACNUC7421 zone)

EMBL: BA000007.YKFJ

BA000007.YKFJ        Location/Qualifiers
FT   CDS             291355..291621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfJ"
FT                   /locus_tag="ECs_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33685"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33685"
FT                   /db_xref="GOA:Q8X7P0"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7P0"
FT                   /protein_id="BAB33685.1"
FT                   /translation="MEWYMGKYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQR
FT                   VVGMPDLHPGRGYPIGAAFFSVGRFYPTRRRGNGAGNRNGPLL"
     MEWYMGKYIR PLSDAVFTIA SDDLWIESLA IQQLHTTANL PNMQRVVGMP DLHPGRGYPI        60
     GAAFFSVGRF YPTRRRGNGA GNRNGPLL                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page