(data stored in ACNUC7421 zone)

EMBL: BA000007.YKGE

BA000007.YKGE        Location/Qualifiers
FT   CDS             364323..365042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgE"
FT                   /locus_tag="ECs_0344"
FT                   /product="cysteine-rich LutA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33767"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33767"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6E9"
FT                   /protein_id="BAB33767.1"
FT                   /translation="MNVNFFVTCIGDALKSRMARDSVLLLEKLGCRVNFPEKQGCCGQP
FT                   AINSGYIKEAIPGMKNLIAALEDNDDPIISPAGSCTYAVKSYPTYLADEPEWASRAEKV
FT                   AARMQDLTSFIVNKLGVVDVGASLQGRAVYHPSCSLARKLGVKDEPLTLLKNVRGLELL
FT                   TFAEQDTCCGFGGTFSVKMAEISGEMVKEKVAHLMEVRPEYLIGADVSCLLNISGRLQR
FT                   EGQKVKVMHIAEVLMSR"
     MNVNFFVTCI GDALKSRMAR DSVLLLEKLG CRVNFPEKQG CCGQPAINSG YIKEAIPGMK        60
     NLIAALEDND DPIISPAGSC TYAVKSYPTY LADEPEWASR AEKVAARMQD LTSFIVNKLG       120
     VVDVGASLQG RAVYHPSCSL ARKLGVKDEP LTLLKNVRGL ELLTFAEQDT CCGFGGTFSV       180
     KMAEISGEMV KEKVAHLMEV RPEYLIGADV SCLLNISGRL QREGQKVKVM HIAEVLMSR        239
//

If you have problems or comments...

PBIL Back to PBIL home page