(data stored in ACNUC7421 zone)

EMBL: BA000007.YKGF

BA000007.YKGF        Location/Qualifiers
FT   CDS             365053..366480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="ECs_0345"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33768"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33768"
FT                   /db_xref="GOA:Q8X6E7"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6E7"
FT                   /protein_id="BAB33768.1"
FT                   /translation="MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDEL
FT                   GLWEEWRDRAAQIRDHVLSNLDAYLYQLSEKVTQNGGHVYFAKTKEDATRYILQVAQRK
FT                   NARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRH
FT                   QIRRVLHERLGYEGPETPEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPKTHIAVMGMERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAG
FT                   HVDGPEEFHLVIVDNGRSEVLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYKDFKDLPYACSLCTACDNVCPVRIPLSKLILRHRRVMAEKGITAKAE
FT                   QRAIKMFAYANSHPGLWKVGMMAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGE
FT                   SFRSWFKKHQAQEKKNG"
     MSIKTSNTDF KTRIRQQIED PIMRKAVANA QQRIGANRQK MVDELGLWEE WRDRAAQIRD        60
     HVLSNLDAYL YQLSEKVTQN GGHVYFAKTK EDATRYILQV AQRKNARKVV KSKSMVTEEI       120
     GVNHVLQDAG IQVIETDLGE YILQLDQDPP SHVVVPAIHK DRHQIRRVLH ERLGYEGPET       180
     PEAMTLFIRQ KIREDFLSAE IGITGCNFAV AETGSVCLVT NEGNARMCTT LPKTHIAVMG       240
     MERIAPTFAE VDVLITMLAR SAVGARLTGY NTWLTGPREA GHVDGPEEFH LVIVDNGRSE       300
     VLASEFRDVL RCIRCGACMN TCPAYRHIGG HGYGSIYPGP IGAVISPLLG GYKDFKDLPY       360
     ACSLCTACDN VCPVRIPLSK LILRHRRVMA EKGITAKAEQ RAIKMFAYAN SHPGLWKVGM       420
     MAGAHAASWF INGGKTPLKF GAISDWMEAR DLPEADGESF RSWFKKHQAQ EKKNG            475
//

If you have problems or comments...

PBIL Back to PBIL home page