(data stored in ACNUC7421 zone)

EMBL: BA000007.YKGG

BA000007.YKGG        Location/Qualifiers
FT   CDS             366473..367168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgG"
FT                   /locus_tag="ECs_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33769"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33769"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6E5"
FT                   /protein_id="BAB33769.2"
FT                   /translation="MDNRGEFLNNVAQALGRPLRLEPQAEDAPLNNYANERLTQLNQQQ
FT                   RCDAFIQFASDVMLTRCELTSEAKAAEAAIRLCKELGDQSVVISGDTRLEELGISERLQ
FT                   QECNAVVWDPAKGAKNISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPESS
FT                   LFILRKSTLLPRVAQLAERLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVK
FT                   AVYLIIEDC"
     MDNRGEFLNN VAQALGRPLR LEPQAEDAPL NNYANERLTQ LNQQQRCDAF IQFASDVMLT        60
     RCELTSEAKA AEAAIRLCKE LGDQSVVISG DTRLEELGIS ERLQQECNAV VWDPAKGAKN       120
     ISQAEQAKVG VVYAEYGLTE SGGVVLFSAA ERGRSLSLLP ESSLFILRKS TLLPRVAQLA       180
     ERLHQKAQAG ERMPSCINII SGPSSTADIE LIKVVGVHGP VKAVYLIIED C                231
//

If you have problems or comments...

PBIL Back to PBIL home page