(data stored in ACNUC7421 zone)

EMBL: BA000007.YKGM

BA000007.YKGM        Location/Qualifiers
FT   CDS             complement(344923..345189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgM"
FT                   /locus_tag="ECs_0327"
FT                   /product="50S ribosomal protein L31 type B"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33750"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33750"
FT                   /db_xref="GOA:P0A7N3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7N3"
FT                   /protein_id="BAB33750.2"
FT                   /translation="MMKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPY
FT                   VTIDVSSKSHPFYTGKLRTVASEGNVARFTQRFGRFVSTKKGA"
     MMKPNIHPEY RTVVFHDTSV DEYFKIGSTI KTDREIELDG VTYPYVTIDV SSKSHPFYTG        60
     KLRTVASEGN VARFTQRFGR FVSTKKGA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page