(data stored in ACNUC7421 zone)

EMBL: BA000007.YLBA

BA000007.YLBA        Location/Qualifiers
FT   CDS             complement(635770..636555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbA"
FT                   /locus_tag="ECs_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34000"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34000"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCV9"
FT                   /protein_id="BAB34000.1"
FT                   /translation="MGYLNNVTGYRDDLLANRAIVKHGNFALLTPDGLVKNIIPGFENC
FT                   DATILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVISGNITAKAEGKTFSLS
FT                   EGGYLYCPPGSLMTFVNAQAEDSQIFLYKRRYVPVEGYAPWLVSGNASELERIHYEGMD
FT                   DVILLDFLPKELGFDMNMHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPV
FT                   KKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVEI"
     MGYLNNVTGY RDDLLANRAI VKHGNFALLT PDGLVKNIIP GFENCDATIL STPKLGASFV        60
     DYLVTLHQNG GNQQGFGGEG IETFLYVISG NITAKAEGKT FSLSEGGYLY CPPGSLMTFV       120
     NAQAEDSQIF LYKRRYVPVE GYAPWLVSGN ASELERIHYE GMDDVILLDF LPKELGFDMN       180
     MHILSFAPGA SHGYIETHVQ EHGAYILSGQ GVYNLDNNWI PVKKGDYIFM GAYSLQAGYG       240
     VGRGEAFSYI YSKDCNRDVE I                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page