(data stored in ACNUC7421 zone)

EMBL: BA000007.YLBE

BA000007.YLBE        Location/Qualifiers
FT   CDS             640866..642125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbE"
FT                   /locus_tag="ECs_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34004"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34004"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCV6"
FT                   /protein_id="BAB34004.2"
FT                   /translation="MFTSVAQANAAVIEQIRRARPHWLDVQPASSLISELNEGKTLLHA
FT                   GPPMRWQEMTGPMKGACVGACLFEGWAKDEAQALAILEQGEVNFIPCHHVNAVGPMGGI
FT                   TSASMPMLVVENVTDGNRAYCNLNEGIGKVMRFGAYGEDVLTRHRWMRDVLMPVLSAAL
FT                   GRMERGIDLTAMMAQGITMGDEFHQRNIASSALLMRALAPQIARLDHDKQHIAEVMDFL
FT                   SVTDQFFLNLAMAYCKAAMDAGAMIRAGSIVTAMTRNGNMFGIRVSGLGERWFTAPVNT
FT                   PQGLFFTGFSQEQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGASGMEAARAVSEEM
FT                   AEIYLERNMQLQIPSWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVR
FT                   APLACFEQALEALAESMGIG"
     MFTSVAQANA AVIEQIRRAR PHWLDVQPAS SLISELNEGK TLLHAGPPMR WQEMTGPMKG        60
     ACVGACLFEG WAKDEAQALA ILEQGEVNFI PCHHVNAVGP MGGITSASMP MLVVENVTDG       120
     NRAYCNLNEG IGKVMRFGAY GEDVLTRHRW MRDVLMPVLS AALGRMERGI DLTAMMAQGI       180
     TMGDEFHQRN IASSALLMRA LAPQIARLDH DKQHIAEVMD FLSVTDQFFL NLAMAYCKAA       240
     MDAGAMIRAG SIVTAMTRNG NMFGIRVSGL GERWFTAPVN TPQGLFFTGF SQEQANPDMG       300
     DSAITETFGI GGAAMIAAPG VTRFVGASGM EAARAVSEEM AEIYLERNMQ LQIPSWDFQG       360
     ACLGLDIRRV VETGITPLIN TGIAHKEAGI GQIGAGTVRA PLACFEQALE ALAESMGIG        419
//

If you have problems or comments...

PBIL Back to PBIL home page