(data stored in ACNUC7421 zone)

EMBL: BA000007.YNCI

BA000007.YNCI        Location/Qualifiers
FT   CDS             276198..277370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yncI"
FT                   /locus_tag="ECs_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33668"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33668"
FT                   /db_xref="GOA:Q8X7R5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7R5"
FT                   /protein_id="BAB33668.1"
FT                   /translation="MSIQSLLDYISVIPDIRQQGKVKHKLSDILFLTVCAVIAGADEWQ
FT                   EIEDFGHERLEWLKKYGDFDNGIPVDDTIARVVSNIDSLAFEKIFIEWMQECHEITDGE
FT                   IIAIDGKTIRGSFDKGKRKGAIHMVSAFSNENGVVLGQVKTEAKSNEITAIPELLNLLD
FT                   LKKNLITIDAMGCQKDIASKIKDKKADYLLAVKGNQGKLHHAFEEKFPVNVFSNYKGDS
FT                   FSTQEISHGRKETRLHIVSNVTPEFCDFEFEWKGLKKLCVALSFRQKKEDKSAEGVSIR
FT                   YYISSKDMDAKEFAHAIRAHWLIEHSLHWVLDVKMNEDASRIRRGNAAEIISGIKKMAL
FT                   NLLRDCKDIKGGVKRKRKKVALNTCYIEEVLASCSELGFRTDKMKNLTQI"
     MSIQSLLDYI SVIPDIRQQG KVKHKLSDIL FLTVCAVIAG ADEWQEIEDF GHERLEWLKK        60
     YGDFDNGIPV DDTIARVVSN IDSLAFEKIF IEWMQECHEI TDGEIIAIDG KTIRGSFDKG       120
     KRKGAIHMVS AFSNENGVVL GQVKTEAKSN EITAIPELLN LLDLKKNLIT IDAMGCQKDI       180
     ASKIKDKKAD YLLAVKGNQG KLHHAFEEKF PVNVFSNYKG DSFSTQEISH GRKETRLHIV       240
     SNVTPEFCDF EFEWKGLKKL CVALSFRQKK EDKSAEGVSI RYYISSKDMD AKEFAHAIRA       300
     HWLIEHSLHW VLDVKMNEDA SRIRRGNAAE IISGIKKMAL NLLRDCKDIK GGVKRKRKKV       360
     ALNTCYIEEV LASCSELGFR TDKMKNLTQI                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page