(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0025

BA000012.MLL0025     Location/Qualifiers
FT   CDS             complement(20875..21372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0025"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47701"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47701"
FT                   /db_xref="GOA:Q98NR0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NR0"
FT                   /protein_id="BAB47701.1"
FT                   /translation="MPLLLKGSCRCNAVRFEVESHTPVPFMLCYCSICRKQQGGGGFAI
FT                   NLGAAYETLNIRGKRSLGVYRAEIEDDEHPHCEVSTGERNFCRKCGSALWLYDPTWPEL
FT                   VHPFASAIDSDLPKPPSRVHLMLKYKANWVEPVIGKGDKTFDVYPEESIADWHKLTGMW
FT                   VD"
     MPLLLKGSCR CNAVRFEVES HTPVPFMLCY CSICRKQQGG GGFAINLGAA YETLNIRGKR        60
     SLGVYRAEIE DDEHPHCEVS TGERNFCRKC GSALWLYDPT WPELVHPFAS AIDSDLPKPP       120
     SRVHLMLKYK ANWVEPVIGK GDKTFDVYPE ESIADWHKLT GMWVD                       165
//

If you have problems or comments...

PBIL Back to PBIL home page