(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0029

BA000012.MLL0029     Location/Qualifiers
FT   CDS             complement(22778..23722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0029"
FT                   /product="carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47704"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47704"
FT                   /db_xref="GOA:Q98NQ7"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NQ7"
FT                   /protein_id="BAB47704.1"
FT                   /translation="MVKSIEILAVGGAHIDRRGQVSGAYVPAASNPGTMREDVGGGVFN
FT                   ALRSTVRRGVSGSLMSMRGGDAGADTISRAIAQAGIADLSAVFLDRTTPSYTALIDREG
FT                   ELIVGFADMALYDLAFPKQMRRSKVREAIAAADAILCDANLPSAALERLVSLAAGKPVY
FT                   AIAISPAKVVRLIPVLGALALVFMNRREAVALAGVNANAAERDVIDGLRCSGLTSGVVT
FT                   AGSAPVLGFDEAGAFSIQPPAPRKVANVTGAGDALAGATVAALLHGLPLRQALREGIAA
FT                   ATLAIESADAIPDFTAASFAEVLALVPNAQEVA"
     MVKSIEILAV GGAHIDRRGQ VSGAYVPAAS NPGTMREDVG GGVFNALRST VRRGVSGSLM        60
     SMRGGDAGAD TISRAIAQAG IADLSAVFLD RTTPSYTALI DREGELIVGF ADMALYDLAF       120
     PKQMRRSKVR EAIAAADAIL CDANLPSAAL ERLVSLAAGK PVYAIAISPA KVVRLIPVLG       180
     ALALVFMNRR EAVALAGVNA NAAERDVIDG LRCSGLTSGV VTAGSAPVLG FDEAGAFSIQ       240
     PPAPRKVANV TGAGDALAGA TVAALLHGLP LRQALREGIA AATLAIESAD AIPDFTAASF       300
     AEVLALVPNA QEVA                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page