(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0051

BA000012.MLL0051     Location/Qualifiers
FT   CDS             complement(39311..40495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0051"
FT                   /product="bicyclomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47720"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47720"
FT                   /db_xref="GOA:Q98NP1"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NP1"
FT                   /protein_id="BAB47720.1"
FT                   /translation="MALNSLAIDIMLPALQQIGASLGVENENHRQYVVTAYILGFGGGQ
FT                   LFFGPISDRFGRRSPLVAGLIIYVAAAAAAAIAPSFETLLICRAVQGIGAAATRVIAVS
FT                   IVRDTFEGRRMAEVMSLIFMVFMAIPVIAPGIGQFIMLFATWHYIFVTMAVGALIVSAW
FT                   SLLRLPETLRPEYRRQLTVSSVLGGFRIVLTNRIALCYAFASTFIFAAMFGFIASAQQI
FT                   YVGIFNVGEMFPVIFAGVAGVLAFSNFLNSRLVGRIGMRRLSQSALLLFLVISLAWLVV
FT                   SLEIKMPLWLFITFFASAMLPFGALGANFNALAMEPLGQLAGTASSILGFMQTFLGGIL
FT                   GTLIGQAFNGTVTPLAAGFCSVSVAALLMILIAERGKMFQPHNPPISGHITDLH"
     MALNSLAIDI MLPALQQIGA SLGVENENHR QYVVTAYILG FGGGQLFFGP ISDRFGRRSP        60
     LVAGLIIYVA AAAAAAIAPS FETLLICRAV QGIGAAATRV IAVSIVRDTF EGRRMAEVMS       120
     LIFMVFMAIP VIAPGIGQFI MLFATWHYIF VTMAVGALIV SAWSLLRLPE TLRPEYRRQL       180
     TVSSVLGGFR IVLTNRIALC YAFASTFIFA AMFGFIASAQ QIYVGIFNVG EMFPVIFAGV       240
     AGVLAFSNFL NSRLVGRIGM RRLSQSALLL FLVISLAWLV VSLEIKMPLW LFITFFASAM       300
     LPFGALGANF NALAMEPLGQ LAGTASSILG FMQTFLGGIL GTLIGQAFNG TVTPLAAGFC       360
     SVSVAALLMI LIAERGKMFQ PHNPPISGHI TDLH                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page