(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0062

BA000012.MLL0062     Location/Qualifiers
FT   CDS             complement(47167..47490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0062"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47729"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47729"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NN2"
FT                   /protein_id="BAB47729.1"
FT                   /translation="MPSGKSAALLAMEQVAISAHKCWIASKDPAFKQYQMANELNSFSG
FT                   TPRFLLVPAKHYGGKPLLVVQAQGNSSRVDVFGPLMNDPLGARIGSDIARWQTGNPGCA
FT                   ATA"
     MPSGKSAALL AMEQVAISAH KCWIASKDPA FKQYQMANEL NSFSGTPRFL LVPAKHYGGK        60
     PLLVVQAQGN SSRVDVFGPL MNDPLGARIG SDIARWQTGN PGCAATA                     107
//

If you have problems or comments...

PBIL Back to PBIL home page