(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0081

BA000012.MLL0081     Location/Qualifiers
FT   CDS             complement(56916..57590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0081"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47741"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47741"
FT                   /db_xref="InterPro:IPR018725"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM0"
FT                   /protein_id="BAB47741.1"
FT                   /translation="MIVAQAGDVAELEILGFSKDGGVFAFEEYGVQDGSGFPYANRYYI
FT                   DTSTDSFLKGTPIRVRLDDENAKLDAARLQARQKGEAIVSQAELSANRGITAGFNPVTE
FT                   LSADPHRMAVNPRPIFSPVDQPLEFRLDEIGMNNTEGCDSQGEINGFRLLRIEAQDGGT
FT                   TKLLHEDKSIPKSRSCPNGYRIGAVQTFSMDSLSAYAVLIAVRQYGFEGPDFRWIAVTG
FT                   RL"
     MIVAQAGDVA ELEILGFSKD GGVFAFEEYG VQDGSGFPYA NRYYIDTSTD SFLKGTPIRV        60
     RLDDENAKLD AARLQARQKG EAIVSQAELS ANRGITAGFN PVTELSADPH RMAVNPRPIF       120
     SPVDQPLEFR LDEIGMNNTE GCDSQGEING FRLLRIEAQD GGTTKLLHED KSIPKSRSCP       180
     NGYRIGAVQT FSMDSLSAYA VLIAVRQYGF EGPDFRWIAV TGRL                        224
//

If you have problems or comments...

PBIL Back to PBIL home page