(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0095

BA000012.MLL0095     Location/Qualifiers
FT   CDS             complement(66795..67847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0095"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47752"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47752"
FT                   /db_xref="InterPro:IPR009560"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK9"
FT                   /protein_id="BAB47752.1"
FT                   /translation="MRRVLLAATAFLSLTISGQAALAADDAPEAPYVDDRSSAEAVIRS
FT                   LYSAINRHEFARAWGYYGDTKPAKDFDSFVKGYDGTDKVEVTTGAISDDGAAGSIFYNV
FT                   PVAIRATDKSGGEKVFAGCYTLRQVNAQAQAAPPFDPIHIEKGALKPSTADFEAALPPS
FT                   CGDGPPPPKKDTALEQARKAFLATYGDQCDKQFLGNEPEVFSIKYKDKDARPGDPDKEA
FT                   RLFRFSCSAAAYNESSVYYMTDELSEVRQLQFAEPKMDIRYENNNSDGKLLGMSIVGFE
FT                   TTGWAVNSDYDPDTHTITTFDKWRGVGDASDSGTYLFRNGDFSLVQYDVDASYDGQENP
FT                   QTVVDYNTAP"
     MRRVLLAATA FLSLTISGQA ALAADDAPEA PYVDDRSSAE AVIRSLYSAI NRHEFARAWG        60
     YYGDTKPAKD FDSFVKGYDG TDKVEVTTGA ISDDGAAGSI FYNVPVAIRA TDKSGGEKVF       120
     AGCYTLRQVN AQAQAAPPFD PIHIEKGALK PSTADFEAAL PPSCGDGPPP PKKDTALEQA       180
     RKAFLATYGD QCDKQFLGNE PEVFSIKYKD KDARPGDPDK EARLFRFSCS AAAYNESSVY       240
     YMTDELSEVR QLQFAEPKMD IRYENNNSDG KLLGMSIVGF ETTGWAVNSD YDPDTHTITT       300
     FDKWRGVGDA SDSGTYLFRN GDFSLVQYDV DASYDGQENP QTVVDYNTAP                  350
//

If you have problems or comments...

PBIL Back to PBIL home page