(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0105

BA000012.MLL0105     Location/Qualifiers
FT   CDS             complement(73615..74118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0105"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47760"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47760"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK1"
FT                   /protein_id="BAB47760.1"
FT                   /translation="MERVLVSACLLGSHVRYNGSYRLDGHPVLTRWQAEGRVVQICPEV
FT                   AAGFSTPRPAAEIHGTADAVLDGQGRVVEQTGSDVTALYLEAGQLALELARETGCRYAV
FT                   LTDGSPSCGSSFVFDGSFSGKRVAGRGTTAALLEANGIRVFSEDSIGDLDALLNRPGSV
FT                   ETTA"
     MERVLVSACL LGSHVRYNGS YRLDGHPVLT RWQAEGRVVQ ICPEVAAGFS TPRPAAEIHG        60
     TADAVLDGQG RVVEQTGSDV TALYLEAGQL ALELARETGC RYAVLTDGSP SCGSSFVFDG       120
     SFSGKRVAGR GTTAALLEAN GIRVFSEDSI GDLDALLNRP GSVETTA                     167
//

If you have problems or comments...

PBIL Back to PBIL home page