(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0108

BA000012.MLL0108     Location/Qualifiers
FT   CDS             complement(76459..78006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0108"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47763"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47763"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ8"
FT                   /protein_id="BAB47763.1"
FT                   /translation="MDGERGEIWCYSDRFSYRPGEMVTLHVSSTAPSFSMAIIRDGGTE
FT                   TKVFEKSGIAACWQDTPDQCSAEGCGWEASFEFRVGSDWPSGAYRVTLTSVGHDGRPIH
FT                   GYHLFIVSPQPGKKPGRVLQVAATGTWLAYNTWGGSNHYQGITGPDRNQYSPVVSTQRP
FT                   WCRGFVVLPKDAPRVPLKVAVPPKTVPRYPHMEWALATGHSKKYASSGWASYDSHFLRF
FT                   AEQAGYAVDLASQHDLHFSPDILDGYDCAVFVGHDEYWTWEMRDAVDNYVERGGHAARF
FT                   AGNFMWQTRLEGEGRRQVCYKYRARAEDPAYRGGDVTRATNSWEAPEIGRPGSATFGLN
FT                   ATRGVYAGWGGCAPRGVRGFPVYRPEHWAFAGTGIYYGDLLGADGHVYGYEVDGLDFEI
FT                   RGGLPYPTATSGAPDGLQVLAVGMASQVEESADIPIEDQFLTDEDGRFTAETLFGEASD
FT                   ANLEKVKRGNGMIVNFPRGKGEVFHAGSCEWVAGLLRQDPMVERVTRNVLDRYLGKS"
     MDGERGEIWC YSDRFSYRPG EMVTLHVSST APSFSMAIIR DGGTETKVFE KSGIAACWQD        60
     TPDQCSAEGC GWEASFEFRV GSDWPSGAYR VTLTSVGHDG RPIHGYHLFI VSPQPGKKPG       120
     RVLQVAATGT WLAYNTWGGS NHYQGITGPD RNQYSPVVST QRPWCRGFVV LPKDAPRVPL       180
     KVAVPPKTVP RYPHMEWALA TGHSKKYASS GWASYDSHFL RFAEQAGYAV DLASQHDLHF       240
     SPDILDGYDC AVFVGHDEYW TWEMRDAVDN YVERGGHAAR FAGNFMWQTR LEGEGRRQVC       300
     YKYRARAEDP AYRGGDVTRA TNSWEAPEIG RPGSATFGLN ATRGVYAGWG GCAPRGVRGF       360
     PVYRPEHWAF AGTGIYYGDL LGADGHVYGY EVDGLDFEIR GGLPYPTATS GAPDGLQVLA       420
     VGMASQVEES ADIPIEDQFL TDEDGRFTAE TLFGEASDAN LEKVKRGNGM IVNFPRGKGE       480
     VFHAGSCEWV AGLLRQDPMV ERVTRNVLDR YLGKS                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page