(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0121

BA000012.MLL0121     Location/Qualifiers
FT   CDS             complement(84642..85283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0121"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47773"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47773"
FT                   /db_xref="GOA:Q98NI8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NI8"
FT                   /protein_id="BAB47773.1"
FT                   /translation="MQAFIDQSVCFIENHQAWAGLVVGLLAFGESLVLVGILLPGTTVL
FT                   IIVGGLVGAGIVQPLPVLLAAMVGAALGDTISYFLGKWLGRSVVHKWPLNRYRREVARA
FT                   RLFFHRYGFAAVFVGRFFGPVRATVPLVAGMMGMHRRRFQIANILSAIIWAPVVLSPGW
FT                   LVAKGAGSIPELDVTSLFGLAAIGVVALIIIAVIALKLRRKRTAAPSRAS"
     MQAFIDQSVC FIENHQAWAG LVVGLLAFGE SLVLVGILLP GTTVLIIVGG LVGAGIVQPL        60
     PVLLAAMVGA ALGDTISYFL GKWLGRSVVH KWPLNRYRRE VARARLFFHR YGFAAVFVGR       120
     FFGPVRATVP LVAGMMGMHR RRFQIANILS AIIWAPVVLS PGWLVAKGAG SIPELDVTSL       180
     FGLAAIGVVA LIIIAVIALK LRRKRTAAPS RAS                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page