(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0122

BA000012.MLL0122     Location/Qualifiers
FT   CDS             complement(85308..86357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0122"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47774"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47774"
FT                   /db_xref="InterPro:IPR009842"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NI7"
FT                   /protein_id="BAB47774.1"
FT                   /translation="MAVETRAALAAGISHDFYKRHPMIALQRLLLVPLLAVLSCGGALL
FT                   AEAAHASALIVVPPGNRSETQPRIPDASATRTRAFKTTYAEKYEKIVALLKREKKLVAH
FT                   IKQVAAAYDIDPIHIVGALVGEHTYNVTAVGSVQTYYVKALSYSGLDFAFRYKGVPVQT
FT                   FVQRPEFAGCAQAKDSASLWSCRDRVWVDHFRGKTVDGVTYDAMTFQQAFFQPFFAGQT
FT                   FGLGQISPLTALEVTDLVNKVSGYDKLTPDHPQAIYRDVMDPDRSIVYIAAIVRDAIDA
FT                   YKEQGFDVSDNPGITATLYNVGQPRQRAADLRAALASGKGRKLPAENYYGWLVNDKLDE
FT                   LRSLLDSGS"
     MAVETRAALA AGISHDFYKR HPMIALQRLL LVPLLAVLSC GGALLAEAAH ASALIVVPPG        60
     NRSETQPRIP DASATRTRAF KTTYAEKYEK IVALLKREKK LVAHIKQVAA AYDIDPIHIV       120
     GALVGEHTYN VTAVGSVQTY YVKALSYSGL DFAFRYKGVP VQTFVQRPEF AGCAQAKDSA       180
     SLWSCRDRVW VDHFRGKTVD GVTYDAMTFQ QAFFQPFFAG QTFGLGQISP LTALEVTDLV       240
     NKVSGYDKLT PDHPQAIYRD VMDPDRSIVY IAAIVRDAID AYKEQGFDVS DNPGITATLY       300
     NVGQPRQRAA DLRAALASGK GRKLPAENYY GWLVNDKLDE LRSLLDSGS                   349
//

If you have problems or comments...

PBIL Back to PBIL home page