(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0144

BA000012.MLL0144     Location/Qualifiers
FT   CDS             complement(100957..101700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0144"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47790"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47790"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NH1"
FT                   /protein_id="BAB47790.1"
FT                   /translation="MTEIVTAAMLVIGDEILSGRTKDKNIGHLADMMTAIGIDLKEVRI
FT                   VPDEEDEIIAAVNAVRARYTYVFTTGGIGPTHDDITADSVAKAFGVPCEYDAKAYALLE
FT                   ASYAARGIEYTEARKRMARMPRGADLIDNPVSVAPGFRIGNVHVMAGVPSIFQAMLDNV
FT                   VPTLKTGTKMLSATVHCPFGEGLVGGPLGEIQKAHPDTIIGSYPKYGDGKFWTELVVRA
FT                   RSQEALDAARADVEAMVAGFAAKAS"
     MTEIVTAAML VIGDEILSGR TKDKNIGHLA DMMTAIGIDL KEVRIVPDEE DEIIAAVNAV        60
     RARYTYVFTT GGIGPTHDDI TADSVAKAFG VPCEYDAKAY ALLEASYAAR GIEYTEARKR       120
     MARMPRGADL IDNPVSVAPG FRIGNVHVMA GVPSIFQAML DNVVPTLKTG TKMLSATVHC       180
     PFGEGLVGGP LGEIQKAHPD TIIGSYPKYG DGKFWTELVV RARSQEALDA ARADVEAMVA       240
     GFAAKAS                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page