(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0155

BA000012.MLL0155     Location/Qualifiers
FT   CDS             complement(109319..109984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0155"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47800"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47800"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG1"
FT                   /protein_id="BAB47800.1"
FT                   /translation="MYRLVVASAGLLAVLSVPALAADPTVDVPMTAPGFDWTGYYAGLQ
FT                   AGYGWGQSDISGTEGEPFSVSPDINGGFVGGHIAGLWQFDQAVIGAEADLNYSSVNGTA
FT                   EAEPGNNFGTDIKWFGSVNAKAGYAMDRVLVYGIGGVAFAGIETSQSAGSAFSETRANV
FT                   GWTLGAGVDYALTDKFVVGAQYRYYDFGSEHYDGSSDFVGRDQDTKLNTVGINLSYKF"
     MYRLVVASAG LLAVLSVPAL AADPTVDVPM TAPGFDWTGY YAGLQAGYGW GQSDISGTEG        60
     EPFSVSPDIN GGFVGGHIAG LWQFDQAVIG AEADLNYSSV NGTAEAEPGN NFGTDIKWFG       120
     SVNAKAGYAM DRVLVYGIGG VAFAGIETSQ SAGSAFSETR ANVGWTLGAG VDYALTDKFV       180
     VGAQYRYYDF GSEHYDGSSD FVGRDQDTKL NTVGINLSYK F                           221
//

If you have problems or comments...

PBIL Back to PBIL home page