(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0158

BA000012.MLL0158     Location/Qualifiers
FT   CDS             complement(112487..113413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0158"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47803"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47803"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NF8"
FT                   /protein_id="BAB47803.1"
FT                   /translation="MPKVHQVGAIERAKGSANSNPAKQFTATNVVHYGDAPQFAKAVGA
FT                   DIAMRGDRALVFVHGFNNGFDDGVYRLTQIAHDTKYPGTPVLFSWASSAKTTGYIYDKD
FT                   SANAARDDLEATLRMLAKTRVKSIDIIAHSMGTWLTMEALRQLAITGDRDLGGKLGYVV
FT                   LASPDIDVDVFKKQMMRYGKPDKPFAVLLSGDDRALKLSSFISGDKPRVGDYGNAADLA
FT                   SYGVSVVDLTKAKGGDGGLNHAKFADNPILVQLLGNRLRTPAGLASDEPDPAQLNNLGQ
FT                   GLGKAVGSVAEVVITTPFKVLTIVTGG"
     MPKVHQVGAI ERAKGSANSN PAKQFTATNV VHYGDAPQFA KAVGADIAMR GDRALVFVHG        60
     FNNGFDDGVY RLTQIAHDTK YPGTPVLFSW ASSAKTTGYI YDKDSANAAR DDLEATLRML       120
     AKTRVKSIDI IAHSMGTWLT MEALRQLAIT GDRDLGGKLG YVVLASPDID VDVFKKQMMR       180
     YGKPDKPFAV LLSGDDRALK LSSFISGDKP RVGDYGNAAD LASYGVSVVD LTKAKGGDGG       240
     LNHAKFADNP ILVQLLGNRL RTPAGLASDE PDPAQLNNLG QGLGKAVGSV AEVVITTPFK       300
     VLTIVTGG                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page