(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0172

BA000012.MLL0172     Location/Qualifiers
FT   CDS             complement(120351..120962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0172"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47813"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47813"
FT                   /db_xref="InterPro:IPR009218"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE8"
FT                   /protein_id="BAB47813.1"
FT                   /translation="MTKMKDQPLIDELLKQELSALYRAEDRHYHNLAHIEAMLALAADH
FT                   RALLSDPQAVEAAIWFHDAIYDSKAKDNEARSAALAAQKLASRTDPERLDRIGAMILAT
FT                   ATHQVPRFHDDAATRDASLFLDMDLSILGAAPHAFDAYERAVRREYGWVEEPMWRAGRG
FT                   AVLKDFLARPRIFHTEEFRQRFEPQARLNMARSLEALTAG"
     MTKMKDQPLI DELLKQELSA LYRAEDRHYH NLAHIEAMLA LAADHRALLS DPQAVEAAIW        60
     FHDAIYDSKA KDNEARSAAL AAQKLASRTD PERLDRIGAM ILATATHQVP RFHDDAATRD       120
     ASLFLDMDLS ILGAAPHAFD AYERAVRREY GWVEEPMWRA GRGAVLKDFL ARPRIFHTEE       180
     FRQRFEPQAR LNMARSLEAL TAG                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page