(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0183

BA000012.MLL0183     Location/Qualifiers
FT   CDS             complement(125874..126482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0183"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47822"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47822"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ND9"
FT                   /protein_id="BAB47822.1"
FT                   /translation="MKKTRGKLLLMAMAMQLSAWGSAYAAGPAYMHTGGRTTQPVGHYE
FT                   FCQRIPGECNEKTPKGAPVDLSRKLWATIVNINNSVNTRVKPRTDMENYGVEEYWAYPD
FT                   NGYGDCEDYALEKRRELMDAGVPAGDLLMTVARQPNGDGHAVLTVRTSLGEFILDNLET
FT                   KVLSWTDTDYTYLKRQSTENSGVWVTINDGRSDAVASVR"
     MKKTRGKLLL MAMAMQLSAW GSAYAAGPAY MHTGGRTTQP VGHYEFCQRI PGECNEKTPK        60
     GAPVDLSRKL WATIVNINNS VNTRVKPRTD MENYGVEEYW AYPDNGYGDC EDYALEKRRE       120
     LMDAGVPAGD LLMTVARQPN GDGHAVLTVR TSLGEFILDN LETKVLSWTD TDYTYLKRQS       180
     TENSGVWVTI NDGRSDAVAS VR                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page