(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0202

BA000012.MLL0202     Location/Qualifiers
FT   CDS             complement(137018..137635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0202"
FT                   /product="leucyl/phenylalanyl-tRNA-protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47837"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47837"
FT                   /db_xref="GOA:Q98NC4"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NC4"
FT                   /protein_id="BAB47837.1"
FT                   /translation="MTRPYAPGYRIPTDLLLKAYASGVFPMAESASDPEVFWVRPETRG
FT                   IIPLDGFHTPKSLRKTIRKSLFDIRFDFDFEATIDGCAEKREERRSTWINAPIREAYVQ
FT                   LHRMGHCHSVEAWREDQLVGGLYGVSLGRVFFGESMFSKETDASKICLVHLVERLKARG
FT                   FALLDTQFTTEHLKRFGAVDVPRGKYEKMLAEALKGEAIFFP"
     MTRPYAPGYR IPTDLLLKAY ASGVFPMAES ASDPEVFWVR PETRGIIPLD GFHTPKSLRK        60
     TIRKSLFDIR FDFDFEATID GCAEKREERR STWINAPIRE AYVQLHRMGH CHSVEAWRED       120
     QLVGGLYGVS LGRVFFGESM FSKETDASKI CLVHLVERLK ARGFALLDTQ FTTEHLKRFG       180
     AVDVPRGKYE KMLAEALKGE AIFFP                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page