(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0207

BA000012.MLL0207     Location/Qualifiers
FT   CDS             complement(139487..139921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0207"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47840"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47840"
FT                   /db_xref="GOA:Q98NC1"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NC1"
FT                   /protein_id="BAB47840.1"
FT                   /translation="MKTVFVLNGPNLNALGKREPGIYGGKTLAAIADDCKQAGASLGLG
FT                   IDFRQSNHEGDLVDWIQEAGDKAAGIVINPGAYSHTSIAIHDAIRSIAPLPVAEVHLSN
FT                   IHARESFRHVSMVAPVAVGMICGFGPLGYTLALQALAARL"
     MKTVFVLNGP NLNALGKREP GIYGGKTLAA IADDCKQAGA SLGLGIDFRQ SNHEGDLVDW        60
     IQEAGDKAAG IVINPGAYSH TSIAIHDAIR SIAPLPVAEV HLSNIHARES FRHVSMVAPV       120
     AVGMICGFGP LGYTLALQAL AARL                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page