(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0208

BA000012.MLL0208     Location/Qualifiers
FT   CDS             complement(140067..140867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0208"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47841"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47841"
FT                   /db_xref="GOA:Q98NC0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NC0"
FT                   /protein_id="BAB47841.1"
FT                   /translation="MKKALLLGTTGVAVVLAMLAFGFVAGSPQMAKAGTAQPVQTAADT
FT                   KIDRAEVEGIIRDYLLKNPEVLLEVQDALEAKQKEEQRIASLGVIKGAKDQIFNSAFDG
FT                   VVGNPNGKVTIVEFYDYNCGFCKRAIEDMRALTKSDPDLRFVLKEFPILGPDSQKASVV
FT                   SMAFHLMMPEKYGEFHNALLGGQGRATEAAAIKVALSLGADEATLREKMKDASIPEAFS
FT                   KTYDLANKLAITGTPSYVVGNEVVFGALGQDVLAEKIKAAKAAL"
     MKKALLLGTT GVAVVLAMLA FGFVAGSPQM AKAGTAQPVQ TAADTKIDRA EVEGIIRDYL        60
     LKNPEVLLEV QDALEAKQKE EQRIASLGVI KGAKDQIFNS AFDGVVGNPN GKVTIVEFYD       120
     YNCGFCKRAI EDMRALTKSD PDLRFVLKEF PILGPDSQKA SVVSMAFHLM MPEKYGEFHN       180
     ALLGGQGRAT EAAAIKVALS LGADEATLRE KMKDASIPEA FSKTYDLANK LAITGTPSYV       240
     VGNEVVFGAL GQDVLAEKIK AAKAAL                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page