(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0225

BA000012.MLL0225     Location/Qualifiers
FT   CDS             complement(158053..158907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0225"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47855"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47855"
FT                   /db_xref="GOA:Q98NA6"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NA6"
FT                   /protein_id="BAB47855.1"
FT                   /translation="MQSCPPRATPARARPDLPPPIGRDREAMSTAANSIAFVSSDTADA
FT                   KAALESLSARYGQCSVAEAVVVVALGGDGFLLQTLRDTMGTGKKVYGMNRGTIGFLMNE
FT                   YRSGGLTERIAAAVAETIRPLEMLAVTSEGETVSALAINEVALWRQSYQTAKIRISVDD
FT                   QIRLEELSCDGVMIATPAGSTAYNLSAHGPILPLDAPLLALTPVSPFRPRRWRGALLSN
FT                   KATVRFDILEPEKRPVNAAADHTEVKAVTSVTVRESPTATATLLFDPNHSWNERILAEQ
FT                   FRY"
     MQSCPPRATP ARARPDLPPP IGRDREAMST AANSIAFVSS DTADAKAALE SLSARYGQCS        60
     VAEAVVVVAL GGDGFLLQTL RDTMGTGKKV YGMNRGTIGF LMNEYRSGGL TERIAAAVAE       120
     TIRPLEMLAV TSEGETVSAL AINEVALWRQ SYQTAKIRIS VDDQIRLEEL SCDGVMIATP       180
     AGSTAYNLSA HGPILPLDAP LLALTPVSPF RPRRWRGALL SNKATVRFDI LEPEKRPVNA       240
     AADHTEVKAV TSVTVRESPT ATATLLFDPN HSWNERILAE QFRY                        284
//

If you have problems or comments...

PBIL Back to PBIL home page