(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0243

BA000012.MLL0243     Location/Qualifiers
FT   CDS             complement(172691..173386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0243"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47871"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47871"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N90"
FT                   /protein_id="BAB47871.1"
FT                   /translation="MKIGIVGAGNIGSALTRLFRAAGHEVTISNSRGPGSLAGLSAETG
FT                   ARAAAIEEAVRGQDVVVVAVPTIKIPGLPRELFASTPADVVVIDTTNYYPQQRDGHLDG
FT                   IEDANTESEWVEQHLGRPVVKAFNTIEATHLLPGAKPAGSADRIALAVAGDDARAKSKA
FT                   MALIDGIGFDAVDAGTIAESWRQQPGSPGYLKDYGVKGVHSALAKANPERQPEWRATPN
FT                   SPGTYDSPA"
     MKIGIVGAGN IGSALTRLFR AAGHEVTISN SRGPGSLAGL SAETGARAAA IEEAVRGQDV        60
     VVVAVPTIKI PGLPRELFAS TPADVVVIDT TNYYPQQRDG HLDGIEDANT ESEWVEQHLG       120
     RPVVKAFNTI EATHLLPGAK PAGSADRIAL AVAGDDARAK SKAMALIDGI GFDAVDAGTI       180
     AESWRQQPGS PGYLKDYGVK GVHSALAKAN PERQPEWRAT PNSPGTYDSP A                231
//

If you have problems or comments...

PBIL Back to PBIL home page