(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0246

BA000012.MLL0246     Location/Qualifiers
FT   CDS             complement(174730..175068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0246"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47873"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47873"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N88"
FT                   /protein_id="BAB47873.1"
FT                   /translation="MAPSRYERCNFLFPIPYSLLPIPSSHPRDMPKPEGERYETDDRGH
FT                   AGPVDIGLLYVADELHQQHPGDDDEGENDDKPDHATLQSEAIASLSYVGSGLVDFSMGR
FT                   RRRHPPPG"
     MAPSRYERCN FLFPIPYSLL PIPSSHPRDM PKPEGERYET DDRGHAGPVD IGLLYVADEL        60
     HQQHPGDDDE GENDDKPDHA TLQSEAIASL SYVGSGLVDF SMGRRRRHPP PG               112
//

If you have problems or comments...

PBIL Back to PBIL home page