(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0249

BA000012.MLL0249     Location/Qualifiers
FT   CDS             complement(175973..176383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0249"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47875"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47875"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N86"
FT                   /protein_id="BAB47875.1"
FT                   /translation="MRKTVQLLLVASLSGCVAPRPDAGDQHVDPIPFSLALEEVVITGI
FT                   RQHLPDPASVRLGRTLAGERTLNGRKEIVVCGFVNGKDPSGGSGGEQAFIARIYPDSAT
FT                   SFDLVAMGSASETRRLVDSTCSAAGLPISDSA"
     MRKTVQLLLV ASLSGCVAPR PDAGDQHVDP IPFSLALEEV VITGIRQHLP DPASVRLGRT        60
     LAGERTLNGR KEIVVCGFVN GKDPSGGSGG EQAFIARIYP DSATSFDLVA MGSASETRRL       120
     VDSTCSAAGL PISDSA                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page