(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0364

BA000012.MLL0364     Location/Qualifiers
FT   CDS             complement(257669..258262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0364"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47961"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47961"
FT                   /db_xref="GOA:Q98N02"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N02"
FT                   /protein_id="BAB47961.1"
FT                   /translation="MHELDPEFRAPLSDWTDVRRWRKAERERLIGARLAVSADARAAMS
FT                   QRIAEGLDTIIGEIRGRMVSLYWPFRGEPDLRPWMASINEHGGRTALPIVVEKGHPLIF
FT                   RAYKPGDRLEKGVWNIPIPAEGDPVLPDIVIAPIVGIDPANYRLGYGGGFFDRTLAAMP
FT                   FKPLVIGVGYELQRIATICPQPHDIPMDRIVTEA"
     MHELDPEFRA PLSDWTDVRR WRKAERERLI GARLAVSADA RAAMSQRIAE GLDTIIGEIR        60
     GRMVSLYWPF RGEPDLRPWM ASINEHGGRT ALPIVVEKGH PLIFRAYKPG DRLEKGVWNI       120
     PIPAEGDPVL PDIVIAPIVG IDPANYRLGY GGGFFDRTLA AMPFKPLVIG VGYELQRIAT       180
     ICPQPHDIPM DRIVTEA                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page