(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0394

BA000012.MLL0394     Location/Qualifiers
FT   CDS             complement(279044..279547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0394"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47983"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47983"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MY0"
FT                   /protein_id="BAB47983.1"
FT                   /translation="MSNAELANSLLLACQQRGIMLATAESCTGGLIIAALTDIAGSSAV
FT                   VDRGFITYSNEAKMDMLGVAAKTLDAHGAVSRETVLEMAAGALAHSRASLSLAVTGIAG
FT                   PSGGSADKPVGLVWFGLALAGQPVVAERQLFGHKGREFIRHETVRHALQFGLRALGQGT
FT                   DSPR"
     MSNAELANSL LLACQQRGIM LATAESCTGG LIIAALTDIA GSSAVVDRGF ITYSNEAKMD        60
     MLGVAAKTLD AHGAVSRETV LEMAAGALAH SRASLSLAVT GIAGPSGGSA DKPVGLVWFG       120
     LALAGQPVVA ERQLFGHKGR EFIRHETVRH ALQFGLRALG QGTDSPR                     167
//

If you have problems or comments...

PBIL Back to PBIL home page