(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0428

BA000012.MLL0428     Location/Qualifiers
FT   CDS             complement(310805..311530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0428"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48012"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48012"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV1"
FT                   /protein_id="BAB48012.1"
FT                   /translation="MVARALSSGMARDPLKVIENRRRYNAKHREELLAKGRSPASLEKQ
FT                   RKRRAENPEKTAEHRRLFKLRHPDRVKAGWKAYRVANSEKIAAYYATYSVEHKAEILAT
FT                   DRVYRAKNRDKVEMWQERRKLKARSISAIRHNPDEVYRVVSRAVSSALPRFMRDDVINS
FT                   MLLAVLEGELLLQNVGARVKDYLGRYNKQYDTFKTLSLDAPMGGADLRRIDLLAAPEPE
FT                   QEEEEDPDIVMLRGGLSRW"
     MVARALSSGM ARDPLKVIEN RRRYNAKHRE ELLAKGRSPA SLEKQRKRRA ENPEKTAEHR        60
     RLFKLRHPDR VKAGWKAYRV ANSEKIAAYY ATYSVEHKAE ILATDRVYRA KNRDKVEMWQ       120
     ERRKLKARSI SAIRHNPDEV YRVVSRAVSS ALPRFMRDDV INSMLLAVLE GELLLQNVGA       180
     RVKDYLGRYN KQYDTFKTLS LDAPMGGADL RRIDLLAAPE PEQEEEEDPD IVMLRGGLSR       240
     W                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page