(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0443

BA000012.MLL0443     Location/Qualifiers
FT   CDS             complement(320053..321102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0443"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48026"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48026"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT7"
FT                   /protein_id="BAB48026.1"
FT                   /translation="MPMPRDGSGVMSWPPNGNAVTATPIDSSKYNARFADLLSDLNAAR
FT                   PITAGGTGANTAIGGNDNLNTAGANIASASTVNLASATGVAVTITGVARINSFGTAAAG
FT                   VERVLTFAGVLPLTYNATSMILPGAADIVTAVGDVGTFRSLGGGNWRCVSYETADGQPI
FT                   SSTFTSSQTFNAGLAANNSTGQAIGVLAGPAATATLFYGHALAGAGNAAFITLDRPGSF
FT                   AANFGIDTDNKWKVGGFSMGANAYEIVHMGNYTTLLDPRYFQTANFASTLAGLAVGAVG
FT                   TSALLGANPAADLSPGNTVAGSNLRFTHAGGFVGSGATAPSGTWRAMGNTTSAGFNTSA
FT                   GATVFLRIS"
     MPMPRDGSGV MSWPPNGNAV TATPIDSSKY NARFADLLSD LNAARPITAG GTGANTAIGG        60
     NDNLNTAGAN IASASTVNLA SATGVAVTIT GVARINSFGT AAAGVERVLT FAGVLPLTYN       120
     ATSMILPGAA DIVTAVGDVG TFRSLGGGNW RCVSYETADG QPISSTFTSS QTFNAGLAAN       180
     NSTGQAIGVL AGPAATATLF YGHALAGAGN AAFITLDRPG SFAANFGIDT DNKWKVGGFS       240
     MGANAYEIVH MGNYTTLLDP RYFQTANFAS TLAGLAVGAV GTSALLGANP AADLSPGNTV       300
     AGSNLRFTHA GGFVGSGATA PSGTWRAMGN TTSAGFNTSA GATVFLRIS                   349
//

If you have problems or comments...

PBIL Back to PBIL home page