(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0449

BA000012.MLL0449     Location/Qualifiers
FT   CDS             complement(326235..326927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0449"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48030"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48030"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT3"
FT                   /protein_id="BAB48030.1"
FT                   /translation="MATPFDGSNDATESRLLQLGRERLDPILAQQSDALQTQLSNQGIK
FT                   LGSAAYDRAMTQQALHANDATDQLILQGHGQAFAEGQAIRNQPINEITALLSGSQVSNP
FT                   QAAAYTPSTIPTTDNAGIIANNYQQKMDAYNAQMSQASSLAGGLFGLGGKLISLSDDDA
FT                   KKDKERLADITPEMGLWKFHYKGEPADAPMRLGLMASEVEKVRPDAVSRRPDGYRQVDY
FT                   GKALSLGA"
     MATPFDGSND ATESRLLQLG RERLDPILAQ QSDALQTQLS NQGIKLGSAA YDRAMTQQAL        60
     HANDATDQLI LQGHGQAFAE GQAIRNQPIN EITALLSGSQ VSNPQAAAYT PSTIPTTDNA       120
     GIIANNYQQK MDAYNAQMSQ ASSLAGGLFG LGGKLISLSD DDAKKDKERL ADITPEMGLW       180
     KFHYKGEPAD APMRLGLMAS EVEKVRPDAV SRRPDGYRQV DYGKALSLGA                  230
//

If you have problems or comments...

PBIL Back to PBIL home page