(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0453

BA000012.MLL0453     Location/Qualifiers
FT   CDS             complement(329261..329962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0453"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48033"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48033"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT0"
FT                   /protein_id="BAB48033.1"
FT                   /translation="MTILSVIQQVCPVIGLNVPTAVFSATDRELVELQALSNEMAQRIA
FT                   FDTRDWTKFKTLCTLTGDGSTVGFNFPSDYKRMLKKARVWPSASPFAPYTHYSDTDQWL
FT                   GITVQNFRSIIGAWTMIGEQILIKPAMANLSTAQFYYITNQIIKDKDGAPKVAFTADDD
FT                   VFRLDERVLKLGMIWQWKANKGQAYAEDMTNYEDALAVYAGADKGSNIIAVGRGRTPVD
FT                   TDLAFPGIITP"
     MTILSVIQQV CPVIGLNVPT AVFSATDREL VELQALSNEM AQRIAFDTRD WTKFKTLCTL        60
     TGDGSTVGFN FPSDYKRMLK KARVWPSASP FAPYTHYSDT DQWLGITVQN FRSIIGAWTM       120
     IGEQILIKPA MANLSTAQFY YITNQIIKDK DGAPKVAFTA DDDVFRLDER VLKLGMIWQW       180
     KANKGQAYAE DMTNYEDALA VYAGADKGSN IIAVGRGRTP VDTDLAFPGI ITP              233
//

If you have problems or comments...

PBIL Back to PBIL home page