(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0459

BA000012.MLL0459     Location/Qualifiers
FT   CDS             complement(333649..333975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0459"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48038"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48038"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS5"
FT                   /protein_id="BAB48038.1"
FT                   /translation="MEFAWFDLGDGRQVFRKVETAKPKRSALSAPMINSDTMSETQSML
FT                   DGKYYTSKSELRKTYRQAGVEEVGNDPARLRRRQKPKVDRKAIKDTVQKAKARFDRGER
FT                   VSPQ"
     MEFAWFDLGD GRQVFRKVET AKPKRSALSA PMINSDTMSE TQSMLDGKYY TSKSELRKTY        60
     RQAGVEEVGN DPARLRRRQK PKVDRKAIKD TVQKAKARFD RGERVSPQ                    108
//

If you have problems or comments...

PBIL Back to PBIL home page