(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0460

BA000012.MLL0460     Location/Qualifiers
FT   CDS             complement(333976..335175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0460"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48039"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48039"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS4"
FT                   /protein_id="BAB48039.1"
FT                   /translation="MAATVIFLTTTGAGTWTVPADWNNSNNSIETIGAGLLGGGAYSKK
FT                   NNVTLTPGGSVNYSVGSASSGVANDTFFGATTFAASICAAKAGGASLGGDAASGIGDVK
FT                   YSGGARGLANGGGGGAAGPHGNGAAGGSGGGSGGGGNGGGSTGAASSFPSGGAGGNNFG
FT                   GTGGGAGGAATALPGAAGTNGGGGGGGSPDDSDTPGVGGNGGNGTEWDATHGSGGGAGA
FT                   GGDASTAGGSGGLYGGGAGRSNLSGGQGIIVITYTPGGAPDITGTLAATLAGGYIANIT
FT                   GTVQPLPPVNQIDMHDGKPREDHAAARNQAKREAHYKLRNAVRKAARKANGAADEPAEQ
FT                   PADLKEMARAIQAEIKTDGIVARLRDIRKLVAEYQAELARLAQEAEDETVAILLLTGDI
FT                   "
     MAATVIFLTT TGAGTWTVPA DWNNSNNSIE TIGAGLLGGG AYSKKNNVTL TPGGSVNYSV        60
     GSASSGVAND TFFGATTFAA SICAAKAGGA SLGGDAASGI GDVKYSGGAR GLANGGGGGA       120
     AGPHGNGAAG GSGGGSGGGG NGGGSTGAAS SFPSGGAGGN NFGGTGGGAG GAATALPGAA       180
     GTNGGGGGGG SPDDSDTPGV GGNGGNGTEW DATHGSGGGA GAGGDASTAG GSGGLYGGGA       240
     GRSNLSGGQG IIVITYTPGG APDITGTLAA TLAGGYIANI TGTVQPLPPV NQIDMHDGKP       300
     REDHAAARNQ AKREAHYKLR NAVRKAARKA NGAADEPAEQ PADLKEMARA IQAEIKTDGI       360
     VARLRDIRKL VAEYQAELAR LAQEAEDETV AILLLTGDI                              399
//

If you have problems or comments...

PBIL Back to PBIL home page