(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0462

BA000012.MLL0462     Location/Qualifiers
FT   CDS             complement(335535..337919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0462"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48041"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48041"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS2"
FT                   /protein_id="BAB48041.1"
FT                   /translation="MIDDDQDAIDTIDDAVDPSLKLKSSKGWLKLITDQEKAGYSDYQE
FT                   KCTNIEKQYADLAKLASVTRDRQFQIFWANIEVLKPSMYSRPPVPAIVPRFQDRSPIPR
FT                   TASEMLERSAAVALQREDIDSVMRQVRDDLAILARGCIWVRYETRSKDNDYTEKVCIDH
FT                   KNRRDFAHDPAREWKEVDWVAGGAWMTKKEMRKRFRSTSGDAYMNAEFATRKDDKNNSD
FT                   GKLKARVWEVWCKSQNKVVWVSPGVDVLLDEGEPHLTLEGFFPCPRPAFGTVQRNSLIP
FT                   VPDFVFYKDQIEEVNDITNRISALSDALRVRGFYPAGAGEIGDAIEAALKSTNDRQIMV
FT                   PVSNWAMLGGSAKDMIVWLPLDMVVQTITQLIQLRKQLIEDIYQISGLSDIMRGETNPN
FT                   ETATAQNIKTQYGSVRIRDRQAELVRIALDTVRIIVEIMAENFKPDTLQEMSLMELPTD
FT                   ADVAKVVKGLENQAQQIVAELQHAKTDPEVQQMAQQNPDAAKQIMDQAQQQVQALSKQV
FT                   DDQKATVTIDQVIKFLRDQKIRAFSLDIETDSTIQPDEQAEKASRAEFLTALAGVLAQL
FT                   GPMVEARPETAPFAAELLKFAIAPFRVGRQMDTAIDEFADNMKAAAAQAKPPPPDPAML
FT                   KAQAEIQALQAKSEAEAQSHAQEHAYKMQTLAAERDVKVQEAQIRVGNENARHARDMQV
FT                   KDADMRSKLAEAGYPPDFSIDGANQMNQAQFQQIMAELTATREQSVQQGQQLGQTLVQA
FT                   LQLVVQSNQDTAKAMIAAATAPKRIVRDHAGRPIGAETVMQ"
     MIDDDQDAID TIDDAVDPSL KLKSSKGWLK LITDQEKAGY SDYQEKCTNI EKQYADLAKL        60
     ASVTRDRQFQ IFWANIEVLK PSMYSRPPVP AIVPRFQDRS PIPRTASEML ERSAAVALQR       120
     EDIDSVMRQV RDDLAILARG CIWVRYETRS KDNDYTEKVC IDHKNRRDFA HDPAREWKEV       180
     DWVAGGAWMT KKEMRKRFRS TSGDAYMNAE FATRKDDKNN SDGKLKARVW EVWCKSQNKV       240
     VWVSPGVDVL LDEGEPHLTL EGFFPCPRPA FGTVQRNSLI PVPDFVFYKD QIEEVNDITN       300
     RISALSDALR VRGFYPAGAG EIGDAIEAAL KSTNDRQIMV PVSNWAMLGG SAKDMIVWLP       360
     LDMVVQTITQ LIQLRKQLIE DIYQISGLSD IMRGETNPNE TATAQNIKTQ YGSVRIRDRQ       420
     AELVRIALDT VRIIVEIMAE NFKPDTLQEM SLMELPTDAD VAKVVKGLEN QAQQIVAELQ       480
     HAKTDPEVQQ MAQQNPDAAK QIMDQAQQQV QALSKQVDDQ KATVTIDQVI KFLRDQKIRA       540
     FSLDIETDST IQPDEQAEKA SRAEFLTALA GVLAQLGPMV EARPETAPFA AELLKFAIAP       600
     FRVGRQMDTA IDEFADNMKA AAAQAKPPPP DPAMLKAQAE IQALQAKSEA EAQSHAQEHA       660
     YKMQTLAAER DVKVQEAQIR VGNENARHAR DMQVKDADMR SKLAEAGYPP DFSIDGANQM       720
     NQAQFQQIMA ELTATREQSV QQGQQLGQTL VQALQLVVQS NQDTAKAMIA AATAPKRIVR       780
     DHAGRPIGAE TVMQ                                                         794
//

If you have problems or comments...

PBIL Back to PBIL home page