(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0469

BA000012.MLL0469     Location/Qualifiers
FT   CDS             complement(343274..343600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0469"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48048"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48048"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR5"
FT                   /protein_id="BAB48048.1"
FT                   /translation="MSDEQQAQMPLDLSTVEPSEPDQTATKPRKTNPWTMDWDDGEEIV
FT                   VNNQSAIAVYTNQKLGIVIRQERTWDEEEDTLIILSTPGAAYRVIEAIQRELEANKERK
FT                   KNGG"
     MSDEQQAQMP LDLSTVEPSE PDQTATKPRK TNPWTMDWDD GEEIVVNNQS AIAVYTNQKL        60
     GIVIRQERTW DEEEDTLIIL STPGAAYRVI EAIQRELEAN KERKKNGG                    108
//

If you have problems or comments...

PBIL Back to PBIL home page