(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0481

BA000012.MLL0481     Location/Qualifiers
FT   CDS             complement(353170..353601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0481"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48060"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48060"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ3"
FT                   /protein_id="BAB48060.1"
FT                   /translation="MDNSDRTGKDPSTGRFLPGHSGFKKVGSRSRVSRQAIDTANEHAA
FT                   TAMTMLVGKMLAGDIRAAEILLRYGADPFLPKNRTVELPDVENPTSENLATAVLSAAWS
FT                   GEISPDEAKQLLDAIAAGKGIIEDAELLRRVEQLEAVKR"
     MDNSDRTGKD PSTGRFLPGH SGFKKVGSRS RVSRQAIDTA NEHAATAMTM LVGKMLAGDI        60
     RAAEILLRYG ADPFLPKNRT VELPDVENPT SENLATAVLS AAWSGEISPD EAKQLLDAIA       120
     AGKGIIEDAE LLRRVEQLEA VKR                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page