(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0501

BA000012.MLL0501     Location/Qualifiers
FT   CDS             complement(368538..369605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0501"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48075"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48075"
FT                   /db_xref="GOA:Q98MN8"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN8"
FT                   /protein_id="BAB48075.1"
FT                   /translation="MKKLLIALMTTTAALSLAASAEAADKLKACWVYTGPIGDFGYSYQ
FT                   HDQGRLEVEKALGDKVETAYLENVSEGPDADRAFERLAREGCKIIFGTSFGFMDAEVKV
FT                   AKKFPKVMFEHATGYKTGDNLGIYNARFYEGRYVLGQIAAKESKSGVAGYIVSFPIPEV
FT                   VMGINSFMLGAQSINPNFKAKIVWVNSWFDPGKEADAAKALFDQGADIIVQHTDSTAAL
FT                   QVAEERKLHGFGQSSDMIKFAPNAQLTSLTDEWGPYYISRVQAAIDGTWKPDNVWLGIK
FT                   DGAVKLAPYTNMPDDVKALAEATEKKIAGGWNPFTGPIAKQDGTPWLKDGEVADDGTLL
FT                   GMNFYVKGVDDKLPQ"
     MKKLLIALMT TTAALSLAAS AEAADKLKAC WVYTGPIGDF GYSYQHDQGR LEVEKALGDK        60
     VETAYLENVS EGPDADRAFE RLAREGCKII FGTSFGFMDA EVKVAKKFPK VMFEHATGYK       120
     TGDNLGIYNA RFYEGRYVLG QIAAKESKSG VAGYIVSFPI PEVVMGINSF MLGAQSINPN       180
     FKAKIVWVNS WFDPGKEADA AKALFDQGAD IIVQHTDSTA ALQVAEERKL HGFGQSSDMI       240
     KFAPNAQLTS LTDEWGPYYI SRVQAAIDGT WKPDNVWLGI KDGAVKLAPY TNMPDDVKAL       300
     AEATEKKIAG GWNPFTGPIA KQDGTPWLKD GEVADDGTLL GMNFYVKGVD DKLPQ            355
//

If you have problems or comments...

PBIL Back to PBIL home page