(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0502

BA000012.MLL0502     Location/Qualifiers
FT   CDS             complement(369657..370577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0502"
FT                   /product="permease protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48076"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48076"
FT                   /db_xref="GOA:Q98MN7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN7"
FT                   /protein_id="BAB48076.1"
FT                   /translation="MDITVNILLTIATAATPLLIAAIGELVVERSGVLNLGVEGMMIMG
FT                   AVGGFGAGYLTGSPWIGLLAAIAMGALFSLLFAVMTLSLATNQVATGLSLTLLGLGLSG
FT                   MIGTSFVGQPGVRLPNLDIPGLSSIPVVGKLLFGQDPVFYISIVLTAAVMWFLFKTRTG
FT                   LTLRSIGDSHTSAHALGIKVIRYRYLAVIFGGACAGLAGGHLSLVYTPQWVENMTAGRG
FT                   WIALALVVFASWRPWRVLAGAYIFGAVWIGQLHAQAFGIPVPSQMLSSLPYLATVVVLV
FT                   LISRNKRLTMMNTPASLGQPFVPDR"
     MDITVNILLT IATAATPLLI AAIGELVVER SGVLNLGVEG MMIMGAVGGF GAGYLTGSPW        60
     IGLLAAIAMG ALFSLLFAVM TLSLATNQVA TGLSLTLLGL GLSGMIGTSF VGQPGVRLPN       120
     LDIPGLSSIP VVGKLLFGQD PVFYISIVLT AAVMWFLFKT RTGLTLRSIG DSHTSAHALG       180
     IKVIRYRYLA VIFGGACAGL AGGHLSLVYT PQWVENMTAG RGWIALALVV FASWRPWRVL       240
     AGAYIFGAVW IGQLHAQAFG IPVPSQMLSS LPYLATVVVL VLISRNKRLT MMNTPASLGQ       300
     PFVPDR                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page