(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0504

BA000012.MLL0504     Location/Qualifiers
FT   CDS             complement(371704..373281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0504"
FT                   /product="ATP-binding protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48078"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48078"
FT                   /db_xref="GOA:Q98MN5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN5"
FT                   /protein_id="BAB48078.1"
FT                   /translation="MGGTVSANHDGANLLEVRGLTKIFGTLTACDHIDLNIAKGEIHAL
FT                   LGENGAGKSTLVKMLFGSLEPNSGEIFWNGQAVRITSPGAAKKLGIGMVFQHFSLFEAL
FT                   TAAENIALSLDDGSPISSIAAKARALSYSYGLPLDPDSLVGDLSVGERQRIEIIRCLLQ
FT                   TPQLIILDEPTSVLTPQEADKLFETLERLRAEGKSILYISHRLEEVKRICDRATVLRHG
FT                   KVVGHCNPREETAASLARMMVGNEVQAVVRAPVEGIETAQPLLEIRSLTRKPATPFSIP
FT                   LKAISLNVRAGEVIGIAGVAGNGQGEFFESVSGEVLQQDAASVRIRGKDAGGLTITGRR
FT                   LLGAAFVPEERLGHGAAPRMKLSENLLLSRHATDGKAFVGTGGMVKSGAIYAASQRIIE
FT                   AMDVRKSAPDPEAAALSGGNLQKFIVGRELDRRPSVMVVNQPTWGVDAGAAAHIRQALI
FT                   ELSRSGSAVLVISQDLDELFEISDAIAVMHNGELSKPMPIAEATFEKVGLLMGGAEPGH
FT                   AEHTLETA"
     MGGTVSANHD GANLLEVRGL TKIFGTLTAC DHIDLNIAKG EIHALLGENG AGKSTLVKML        60
     FGSLEPNSGE IFWNGQAVRI TSPGAAKKLG IGMVFQHFSL FEALTAAENI ALSLDDGSPI       120
     SSIAAKARAL SYSYGLPLDP DSLVGDLSVG ERQRIEIIRC LLQTPQLIIL DEPTSVLTPQ       180
     EADKLFETLE RLRAEGKSIL YISHRLEEVK RICDRATVLR HGKVVGHCNP REETAASLAR       240
     MMVGNEVQAV VRAPVEGIET AQPLLEIRSL TRKPATPFSI PLKAISLNVR AGEVIGIAGV       300
     AGNGQGEFFE SVSGEVLQQD AASVRIRGKD AGGLTITGRR LLGAAFVPEE RLGHGAAPRM       360
     KLSENLLLSR HATDGKAFVG TGGMVKSGAI YAASQRIIEA MDVRKSAPDP EAAALSGGNL       420
     QKFIVGRELD RRPSVMVVNQ PTWGVDAGAA AHIRQALIEL SRSGSAVLVI SQDLDELFEI       480
     SDAIAVMHNG ELSKPMPIAE ATFEKVGLLM GGAEPGHAEH TLETA                       525
//

If you have problems or comments...

PBIL Back to PBIL home page