(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0508

BA000012.MLL0508     Location/Qualifiers
FT   CDS             complement(375417..376034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0508"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48081"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48081"
FT                   /db_xref="InterPro:IPR009758"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN2"
FT                   /protein_id="BAB48081.1"
FT                   /translation="MSGGSSMTDQGWAMKGELVLSCNCTVFCPCVLSLGNHAPTEGYCQ
FT                   TWAGFRIDAGHFGEVDLSGLNLGLIMEIPGYMSRGNWTAGLFIDKRASIYAVKALTKIF
FT                   TGKAGGTTSLLSILVGKFLPITYETRDKMRIFQIPKIIDGAVTPIAGKDREKDTVITNS
FT                   EYWIAPEIIVARSDKSKMRAFGRNWNFAGRSAEICKLDWRGP"
     MSGGSSMTDQ GWAMKGELVL SCNCTVFCPC VLSLGNHAPT EGYCQTWAGF RIDAGHFGEV        60
     DLSGLNLGLI MEIPGYMSRG NWTAGLFIDK RASIYAVKAL TKIFTGKAGG TTSLLSILVG       120
     KFLPITYETR DKMRIFQIPK IIDGAVTPIA GKDREKDTVI TNSEYWIAPE IIVARSDKSK       180
     MRAFGRNWNF AGRSAEICKL DWRGP                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page