(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0525

BA000012.MLL0525     Location/Qualifiers
FT   CDS             complement(388489..389160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0525"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48093"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48093"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM0"
FT                   /protein_id="BAB48093.1"
FT                   /translation="MPPENQGVLPTMMLHNRVRGLCVVLAASAVFAFSSPAFSQDVTES
FT                   HLKAARAAVAAIHATDPFDNILPQAAAALESQLIQKNPDMQELIGKTINEKALALASRR
FT                   ADLEKEAALAYAKVFSEKELNEIAAFYSSDSGKKLLDSGPTVTRDLVKAADIWQNGLAR
FT                   DLAQQVGETLAAAAKAKAPAAPAPADGAAPADNAAPADGAAPADGSAPADGSAPADGTQ
FT                   N"
     MPPENQGVLP TMMLHNRVRG LCVVLAASAV FAFSSPAFSQ DVTESHLKAA RAAVAAIHAT        60
     DPFDNILPQA AAALESQLIQ KNPDMQELIG KTINEKALAL ASRRADLEKE AALAYAKVFS       120
     EKELNEIAAF YSSDSGKKLL DSGPTVTRDL VKAADIWQNG LARDLAQQVG ETLAAAAKAK       180
     APAAPAPADG AAPADNAAPA DGAAPADGSA PADGSAPADG TQN                         223
//

If you have problems or comments...

PBIL Back to PBIL home page